Invitrogen™ Human FLAP (aa 28-71) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30198783	100 μL	100µL

Product Code. 30198783 Supplier Invitrogen™ Supplier No. RP89567

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82926 (PA5-82926. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ALOX5AP is a protein which, with 5-lipoxygenase, is required for leukotriene synthesis. Leukotrienes are arachidonic acid metabolites which have been implicated in various types of inflammatory responses, including asthma, arthritis and psoriasis. This protein localizes to the plasma membrane. Inhibitors of its function impede translocation of 5-lipoxygenase from the cytoplasm to the cell membrane and inhibit 5-lipoxygenase activation.

Specifications

• Accession Number: P20292
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 241
• Name: Human FLAP (aa 28-71) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5-lipoxygenase-activating protein FLAP; Alox5ap; arachidonate 5-lipoxygenase activating protein; arachidonate 5-lipoxygenase-activating protein; Flap; MK-886-binding protein
• Common Name: FLAP
• Gene Symbol: ALOX5AP
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HKVEHESRTQNGRSFQRTGTLAFERVYTANQNCVDAYPTFLAVL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining