Invitrogen™ Human FKBP4 (aa 368-456) Control Fragment Recombinant Protein

Product Code. 30202791

Brand: Invitrogen™ RP105245

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function of this protein remains unknown.

Specifications

• Accession Number: Q02790
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2288
• Name: Human FKBP4 (aa 368-456) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 51 kDa FK506-binding protein; 52 kDa FK506-binding protein; 52 kDa FKBP; 59 kDa immunophilin; 59 kDa; AL022792; AW208983; FK506 binding protein 4; FK506 binding protein 4, 59 kDa; FK506 binding protein 52; FK506-binding protein 4; FK506-binding protein 4 (59 kD); FKBP prolyl isomerase 4; Fkbp4; FKBP-4; FKBP51; FKBP52; FKBP-52; FKBP52 protein; FKBP59; Fkpb52; HBI; HSP binding immunophilin; Hsp56; hsp90 binding protein; HSP-binding immunophilin; immunophilin FKBP52; p52; P59; p59 protein; peptidylprolyl cis-trans isomerase; peptidyl-prolyl cis-trans isomerase FKBP4; Peptidyl-prolyl cis-trans isomerase FKBP4, N-terminally processed; PPIase; PPIase FKBP4; rotamase; T-cell FK506-binding protein, 59 kD
• Common Name: FKBP4
• Gene Symbol: FKBP4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKLYANMFERLAEEENKAKAEASSGDHPTDTEMKEEQKSNTAGSQSQVE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining