Invitrogen™ Human FKBP12 (aa 1-38) Control Fragment Recombinant Protein

Product Code. 30207599

Brand: Invitrogen™ RP101482

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FKBP12 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It interacts with several intracellular signal transduction proteins including type I TGF-beta receptor. It also interacts with multiple intracellular calcium release channels, and coordinates multi-protein complex formation of the tetrameric skeletal muscle ryanodine receptor. In mouse, deletion of this homologous gene causes congenital heart disorder known as noncompaction of left ventricular myocardium.

Specifications

• Accession Number: P62942
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2280
• Name: Human FKBP12 (aa 1-38) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 12 kDa FK506-binding protein; 12 kDa FKBP; calstabin 1; calstabin-1; EC 5.2.1.8; FK506 binding protein 1 A; FK506 binding protein 1 A, 12 kDa; FK506 binding protein 2 (13 kDa); FK506 binding protein12; FK506-binding protein 1; FK506-binding protein 1 (12 kD); FK506-binding protein 12; FK506-binding protein 1 A; FK506-binding protein 1 A (12 kD); FK506-binding protein, T-cell, 12-kD; Fkbp; FKBP1; FKBP12; FKBP-12; FKBP12-Exip3; Fkbp1a; FKBP-1 A; Fkbp2; Immunophilin FKBP12; peptidyl-prolyl cis-trans isomerase FKBP1A; PKC12; PKCI2; PPIASE; PPIase FKBP1A; protein kinase C inhibitor 2; rotamase
• Common Name: FKBP12
• Gene Symbol: FKBP1A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining