Invitrogen™ Human FKBP10 (aa 92-184) Control Fragment Recombinant Protein

Product Code. 30201153

Brand: Invitrogen™ RP109721

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144711 (PA5-144711. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

MAF acts as a transcriptional activator or repressor. The protein is involved in embryonic lens fiber cell development.

Specifications

• Accession Number: Q96AY3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 60681
• Name: Human FKBP10 (aa 92-184) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 65 kDa FK506-binding protein; 65 kDa FKBP; AI325255; BRKS1; FK506 binding protein 10; FK506 binding protein 10, 65 kDa; FK506 binding protein 6 (65 kDa); FK506-binding protein 10; FKBP10; FKBP-10; Fkbp1-rs; Fkbp6; FKBP65; FKBP-65; Fkbprp; Fkbp-rs; Fkbp-rs1; hFKBP65; Immunophilin FKBP65; OI11; OI6; Peptidyl-prolyl cis-trans isomerase FKBP10; PPIASE; PPIase FKBP10; PSEC0056; Rotamase
• Common Name: FKBP10
• Gene Symbol: FKBP10
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VVGVGRLITGMDRGLMGMCVNERRRLIVPPHLGYGSIGLAGLIPPDATLYFDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDGDFVRYHYNGT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining