missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30198401

Invitrogen™ Human FIP200 (aa 359-458) Control Fragment Recombinant Protein

Product Code. 30198401
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30198401

Brand: Invitrogen™ RP93726

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene interacts with signaling pathways to coordinately regulate cell growth, cell proliferation, apoptosis, autophagy, and cell migration. This tumor suppressor also enhances retinoblastoma 1 gene expression in cancer cells. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8TDY2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9821
Name Human FIP200 (aa 359-458) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 200 kDa FAK family kinase-interacting protein; 2900055E04Rik; 5930404L04Rik; ATG17; Cc1; coiled coil forming protein 1; coiled-coil-forming protein 1; FAK family kinase-interacting protein of 200 kDa; FIP200; KIAA0203; LaXp180; LOW QUALITY PROTEIN: RB1-inducible coiled-coil protein 1; phosphatase 1, regulatory subunit 131; PPP1R131; RB1 inducible coiled-coil 1; Rb1cc1; RB1-inducible coiled-coil 1; RB1-inducible coiled-coil protein 1; RBICC
Common Name FIP200
Gene Symbol Rb1cc1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MKAIKGLEDRLYALDQMIASCGRLVNEQKELAQGFLANQKRAENLKDASVLPDLCLSHANQLMIMLQNHRKLLDIKQKCTTAKQELANNLHVRLKWCCFV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.