missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30197072

Invitrogen™ Human FIP1L1 (aa 95-186) Control Fragment Recombinant Protein

Product Code. 30197072
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30197072

Brand: Invitrogen™ RP105096

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84366 (PA5-84366. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FIP1L1 is a component of the cleavage and polyadenylation specificity factor (CPSF) complex that plays a key role in pre-mRNA 3'-end formation, recognizing the AAUAAA signal sequence and interacting with poly(A) polymerase and other factors to bring about cleavage and poly(A) addition. FIP1L1 contributes to poly(A) site recognition and stimulates poly(A) addition. It binds to U-rich RNA sequence elements surrounding the poly(A) site. FIP1L1 may act to tether poly(A) polymerase to the CPSF complex.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q6UN15
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 81608
Name Human FIP1L1 (aa 95-186) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1300019H17Rik; DKFZp586K0717; Factor interacting with PAP; factor interacting with PAPOLA and CPSF1; FIP1; FIP1 like 1; FIP1 like 1 (S. cerevisiae); FIP1 like 1 b (S. cerevisiae); FIP1L1; FIP1L1 cleavage and polyadenylation specific factor subunit; fip1l1b; FIP1-like 1 protein; FLJ33619; hFip1; Pre-mRNA 3'-end-processing factor FIP1; pre-mRNA 3'-end-processing factor FIP1; LOW QUALITY PROTEIN: pre-mRNA 3'-end-processing factor FIP1; rearranged in hypereosinophilia; RHE; Rje; wu:fd36f11; zgc:103421
Common Name FIP1L1
Gene Symbol FIP1L1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DVHVTIGDIKTGAPQYGSYGTAPVNLNIKTGGRVYGTTGTKVKGVDLDAPGSINGVPLLEVDLDSFEDKPWRKPGADLSDYFNYGFNEDTWK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.