Invitrogen™ Human Filensin Control Fragment Recombinant Protein

Code produit. 30180600

Marque: Invitrogen™ RP99408

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59279 (PA5-59279. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, CP49 (also known as phakinin) and the protein product of this gene, filensin, are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament (BF). Mutations in this gene are the cause of autosomal recessive cortical juvenile-onset cataract. Multiple transcript variants encoding different isoforms have been found for this gene.

Spécification

• Accession Number: Q12934
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 631
• Name: Human Filensin Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Beaded filament structural protein 1; beaded filament structural protein 1, filensin; BFSP1; CP115; CP94; CTRCT33; cytoskeletal protein, 115 KD; filensin; Lens fiber cell beaded-filament structural protein CP 115; lens intermediate filament-like heavy; LIFL-H; LOW QUALITY PROTEIN: filensin; RP4-531H16.2
• Common Name: Filensin
• Gene Symbol: BFSP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SAHECHDDEIQLYNEQIETLRKEIEETERVLEKSSYDCRQLAVAQQTLKNELDRYHRIIEIEGNRLTSAFIETPIPLFTQSHGVSLSTGSGGKD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining