missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30207269

Invitrogen™ Human Filamin B (aa 1145-1253) Control Fragment Recombinant Protein

Product Code. 30207269
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30207269 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30207269 Supplier Invitrogen™ Supplier No. RP88633

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52129 (PA5-52129. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FOXK1 is expressed in these cells and regulates cell cycle progression through an interaction with its downstream target the cyclin-dependent kinase inhibitor p21 (CIP). Loss of FOXK1 in mice results in growth retardation and a severe impairment in skeletal muscle regeneration following injury. FOXK1 also shows expression in immature tissues of brain, eye, heart, lung and thymus. It also is predominantly expressed in many malignant tissues, such as tumors of the brain, colon and lymph node.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number O75369
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2317
Name Human Filamin B (aa 1145-1253) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ABP-278; ABP-280; ABP-280 homolog; ABP-280-like protein; actin binding protein 278; actin-binding-like protein; AL024016; AOI; beta-filamin; Fh1; filamin B; filamin B, beta; filamin homolog 1; filamin, beta; filamin-3; FilaminB; Filamin-B; FLN1L; FLN3; FLNB; FLN-B; Larsen syndrome 1 (autosomal dominant); LRS1; SCT; TABP; TAP; thyroid autoantigen; Truncated ABP; Truncated actin-binding protein
Common Name Filamin B
Gene Symbol FLNB
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HGKVGEAGLLSVDCSEAGPGALGLEAVSDSGTKAEVSIQNNKDGTYAVTYVPLTAGMYTLTMKYGGELVPHFPARVKVEPAVDTSRIKVFGPGIEGKDVFREATTDFTV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.