Invitrogen™ Human Filaggrin 2 (aa 280-381) Control Fragment Recombinant Protein

Product Code. 30209748

Brand: Invitrogen™ RP94294

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (68%), Rat (68%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55951 (PA5-55951. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The FLG2 protein is upregulated by calcium, proteolyzed by calpain 1, and is involved in epithelial homeostasis. FLG2 is also required for proper cornification in skin, with defects in this gene being associated with skin diseases. This protein also has a function in skin barrier protection. In fact, in addition to providing a physical barrier, C-terminal fragments of this protein display antimicrobial activity against P. aeruginosa.

Specifications

• Accession Number: Q5D862
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 388698
• Name: Human Filaggrin 2 (aa 280-381) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: filaggrin family member 2; filaggrin-2; FLG2; FLG-2; Ifapsoriasin; IFPS; intermediate filament-associated and psoriasis susceptibility protein; intermediate filament-associated and psoriasis-susceptibility protein
• Common Name: Filaggrin 2
• Gene Symbol: FLG2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CGYSNSSGCGRPQNASSSCQSHRFGGQGNQFSYIQSGCQSGIKGGQGHGCVSGGQPSGCGQPESNPCSQSYSQRGYGARENGQPQNCGGQWRTGSSQSSCCG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining