Invitrogen™ Human Fibulin 1 (aa 266-402) Control Fragment Recombinant Protein

Product Code. 30194650

Brand: Invitrogen™ RP100521

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51612 (PA5-51612. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Fibulin-1 is a modular glycoprotein component of the elastic extracellular matrix fibers, basement membranes and blood. Fibulin-1 self associates as well as binds to calcium, fibronectin, laminin, nidogen and fibrinogen. These interactions, individually or in combination, may account for the observed association of Fibulin-1 with basement membranes, connective tissue, elastic fibers and fibrin clots. Fibulin-1 expression is stimulated by estrogen in ovarian cancer cell lines and has been suggested as both an agent of metastasis in ovarian cancer cells and an indicator for predicting cancer risk or aggressiveness in ovarian carcinomas. Other studies point to the inhibition of cancer cell motility with increasing exposure to Fibulin-1. The exact function of Fibulin-1 in the cell is unknown.

Specifications

• Accession Number: P23142
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2192
• Name: Human Fibulin 1 (aa 266-402) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Basement-membrane protein 90; BM-90; BM-90/fibulin extracellular matrix glyroprotein; extracellular matrix; extracellular matrix and blood protein; FBLN; Fbln1; fbln1c; fbln1d; FIBL1; FIBL-1; fibulin 1; fibulin 1 C; fibulin 1 D; Fibulin1; fibulin-1; fibulin-1 C varible region; fibulin-1 D; LOW QUALITY PROTEIN: fibulin-1; PP213; wu:fc52c06
• Common Name: Fibulin 1
• Gene Symbol: Fbln1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CESGIHNCLPDFICQNTLGSFRCRPKLQCKSGFIQDALGNCIDINECLSISAPCPIGHTCINTEGSYTCQKNVPNCGRGYHLNEEGTRCVDVDECAPPAEPCGKGHRCVNSPGSFRCECKTGYYFDGISRMCVDVNE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining