Invitrogen™ Human FHIT (aa 75-139) Control Fragment Recombinant Protein

Product Code. 30195730

Brand: Invitrogen™ RP92388

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Alterations and deletions of the FHIT gene are strongly linked to the genesis and establishment of human tumors of the lung, cervix, breast, colon, stomach and pancreas. In normal cells, FHIT may act as a tumor suppressor.

Specifications

• Accession Number: P49789
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2272
• Name: Human FHIT (aa 75-139) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AP3A hydrolase; AP3Aase; AW045638; bis(5'-adenosyl)-triphosphatase; bis5'-adenosyl-triphosphatase; Diadenosine 5',5'''-P1,P3-triphosphate hydrolase; dinucleosidetriphosphatase; FHIT; Fra14A2; FRA3B; fragile histidine triad; fragile histidine triad gene; fragile histidine triad protein
• Common Name: FHIT
• Gene Symbol: FHIT
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining