missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30204048

Invitrogen™ Human FGL2 (aa 196-280) Control Fragment Recombinant Protein

Product Code. 30204048
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30204048

Brand: Invitrogen™ RP92705

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55376 (PA5-55376. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Fibrinogen-like protein 2 (Fgl2), also known as fibroleukin, is secreted by T cells and is involved in diseases in which thrombosis plays a pivotal role, such as virus-induced fulminant hepatitis, fetal loss syndrome and xenograft rejection. Constitutively expressed in cytotoxic T cells, Fgl2 exerts immunosuppressive effects on both T cell proliferation and dendritic cell maturation. Fgl2 is a serine protease and directly cleaves prothrombin to thrombin. Fgl2 functions in the pathogenesis of diseases including viral-induced hepatitis and Th1 cytokine-induced fetal loss syndrome.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q14314
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10875
Name Human FGL2 (aa 196-280) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI385601; associated with MHV-3 induced prothrombinase activity; cytotoxic T-lymphocyte-specific protein; Fgl2; Fiblp; fibrinogen like 2; fibrinogen-like 2; fibrinogen-like protein 2; Fibroleukin; musfiblp; Prothrombinase; pT49; similar to Fibroleukin precursor (Fibrinogen-like protein 2) (pT49); T49
Common Name FGL2
Gene Symbol FGL2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQARLDGSTNFTRTWQDYKAGFGNLRR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.