Invitrogen™ Human Fggy (aa 409-490) Control Fragment Recombinant Protein

Product Code. 30198171

Brand: Invitrogen™ RP109956

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145096 (PA5-145096. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FGGY gene ontology annotations related to this gene include neuron cellular homeostasis; pentose metabolic process.

Specifications

• Accession Number: Q96C11
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55277
• Name: Human Fggy (aa 409-490) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310009E04Rik; Fggy; FGGY carbohydrate kinase domain containing; FGGY carbohydrate kinase domain-containing protein; zgc:85818
• Common Name: Fggy
• Gene Symbol: FGGY
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining