Invitrogen™ Human FGFBP2 (aa 110-180) Control Fragment Recombinant Protein

Code produit	Quantity	unitSize
30208981	100 μL	100µL

Code produit 30208981 Fournisseur Invitrogen™ Code fournisseur RP96652

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (31%), Rat (31%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58686 (PA5-58686. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the fibroblast growth factor binding protein family. The encoded protein is a serum protein that is selectively secreted by cytotoxic lymphocytes and may be involved in cytotoxic lymphocyte-mediated immunity. An increase in the amount of gene product may be associated with atopic asthma and mild extrinsic asthma.

Spécification

• Accession Number: Q9BYJ0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 83888
• Name: Human FGFBP2 (aa 110-180) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 37 kDa killer-specific secretory protein; FGF-binding protein 2; FGFBP2; FGF-BP2; FGFBP-2; fibroblast growth factor binding protein 2; fibroblast growth factor-binding protein 2; HBp17-related protein; HBP17RP; HBp17-RP; killer-specific secretory protein of 37 kDa; KSP37; UNQ425/PRO1065
• Common Name: FGFBP2
• Gene Symbol: FGFBP2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PVLRPSVCREAGPQAHMQQVTSSLKGSPEPNQQPEAGTPSLRPKATVKLTEATQLGKDSMEELGKAKPTTR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining