Invitrogen™ Human FGF11 (aa 72-105) Control Fragment Recombinant Protein

Product Code. 30207036

Brand: Invitrogen™ RP107508

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-66853 (PA5-66853, PA5-84977 (PA5-84977. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probably involved in nervous system development and function.

Specifications

• Accession Number: Q92914
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2256
• Name: Human FGF11 (aa 72-105) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FGF; Fgf11; Fgf-11; Fhf3; FHF-3; Fibroblast growth factor; Fibroblast growth factor 11; fibroblast growth factor homologous factor 3
• Common Name: FGF11
• Gene Symbol: FGF11
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining