Invitrogen™ Human FGD4 (aa 120-205) Control Fragment Recombinant Protein

Product Code. 30180544

Brand: Invitrogen™ RP97793

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58706 (PA5-58706. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q96M96
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 121512
• Name: Human FGD4 (aa 120-205) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Actin filament-binding protein frabin; actin-filament binding protein frabin; CMT4H; FGD1 family, member 4; FGD1-related F-actin-binding protein; FGD4; FRABP; FYVE, RhoGEF and PH domain containing 4; FYVE, RhoGEF and PH domain-containing protein 4; ZFYVE6; Zinc finger FYVE domain-containing protein 6
• Common Name: FGD4
• Gene Symbol: FGD4
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPLLDTHIVNGERDETATAPASPTTDSCDGNASDSSYRTPGIGPVLPLEERGAETETKVQERENGESPLELEQLDQHHEMKETNEQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining