Invitrogen™ Human FGD3 (aa 454-558) Control Fragment Recombinant Protein

Product Code. 30200075

Brand: Invitrogen™ RP92948

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54307 (PA5-54307. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FGD3 gene ontology annotations related to this gene include regulation of Rho protein signal transduction.

Specifications

• Accession Number: Q5JSP0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 89846
• Name: Human FGD3 (aa 454-558) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5830461L01Rik; faciogenital dysplasia 3; faciogenital dysplasia homolog 3; Fgd1 family, member 3; FGD3; FGD3 protein; FLJ00004; FYVE, RhoGEF and PH domain containing 3; FYVE, RhoGEF and PH domain-containing protein 3; ZFYVE5; Zinc finger FYVE domain-containing protein 5
• Common Name: FGD3
• Gene Symbol: FGD3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EEEKKEWIQIIQATIEKHKQNSETFKAFGGAFSQDEDPSLSPDMPITSTSPVEPVVTTEGSSGAAGLEPRKLSSKTRRDKEKQSCKSCGETFNSITKRRHHCKLC
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining