Invitrogen™ Human FGD1 (aa 32-137) Control Fragment Recombinant Protein

Product Code. 30212236

Brand: Invitrogen™ RP91933

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51482 (PA5-51482. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FGD1 contains Dbl (DH) and pleckstrin (PH) homology domains. It can bind specifically to the Rho family GTPase Cdc42Hs and stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. FGD1 has an essential role in embryonic development, and FGD1 gene mutations result in the human developmental disorder, Aarskog-Scott syndrome.

Specifications

• Accession Number: P98174
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2245
• Name: Human FGD1 (aa 32-137) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AAS; faciogenital dysplasia 1 protein; Faciogenital dysplasia 1 protein homolog; faciogenital dysplasia protein; Fgd1; FGDY; FYVE, RhoGEF and PH domain containing 1; FYVE, RhoGEF and PH domain containing 1 (faciogenital dysplasia); FYVE, RhoGEF and PH domain-containing protein 1; MRXS16; Rho/Rac GEF; rho/Rac guanine nucleotide exchange factor FGD1; ZFYVE3; zinc finger FYVE domain-containing protein 3
• Common Name: FGD1
• Gene Symbol: FGD1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DSDPGASEPGLLARRGSGSALGGPLDPQFVGPSDTSLGAAPGHRVLPCGPSPQHHRALRFSYHLEGSQPRPGLHQGNRILVKSLSLDPGQSLEPHPEGPQRLRSDP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining