Invitrogen™ Human FERD3L (aa 1-71) Control Fragment Recombinant Protein

Product Code. 30181989

Brand: Invitrogen™ RP98483

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (59%), Rat (59%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60389 (PA5-60389. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FERD3L is an evolutionarily conserved bHLH transcription factor that is identified in fly, mouse and man. Nervous system expression of this protein is detected in fly and mouse.

Specifications

• Accession Number: Q96RJ6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 222894
• Name: Human FERD3L (aa 1-71) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Basic helix-loop-helix protein N-twist; bHLHa31; Class A basic helix-loop-helix protein 31; fer3; Fer3-like (Drosophila); Fer3-like bHLH transcription factor; fer3-like protein; FERD3L; Mnato3; Nato; NATO3; nephew of atonal 3; Neuronal twist; NTWIST; N-TWIST
• Common Name: FERD3L
• Gene Symbol: FERD3L
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MAAYPESCVDTTVLDFVADLSLASPRRPLLCDFAPGVSLGDPALALREGRPRRMARFEEGDPEEEECEVDQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining