Invitrogen™ Human FEM1C (aa 391-477) Control Fragment Recombinant Protein

Product Code. 30210320

Brand: Invitrogen™ RP107035

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111513 (PA5-111513. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Probable component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit.

Specifications

• Accession Number: Q96JP0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56929
• Name: Human FEM1C (aa 391-477) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610312A07Rik; 3632443A22Rik; AI646567; EUROIMAGE686608; EUROIMAGE783647; fem-1 homolog C; fem-1 homolog c (C. elegans); fem-1 homolog c (C.elegans); FEM1A; FEM1c; FEM1-gamma; feminization 1 homolog a; feminization 1 homolog c; KIAA1785; Protein fem-1 homolog C; protein fem-1 homolog C pseudogene; protein fem-1 homolog C-like
• Common Name: FEM1C
• Gene Symbol: FEM1C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SFMLQDRAKGLLGTTVTFDDLMGILCKSVLEIERAIKQTQCPADPLQLNKALSIILHLICLLEKVPCTLEQDHFKKQTIYRFLKLHP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining