Invitrogen™ Human FCER1G (aa 47-86) Control Fragment Recombinant Protein

Product Code. 30201600

Brand: Invitrogen™ RP90352

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82941 (PA5-82941. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The high affinity IgE receptor is a key molecule involved in allergic reactions. It is a tetramer composed of 1 alpha, 1 beta, and 2 gamma chains. The gamma chains are also subunits of other Fc receptors.

Specifications

• Accession Number: P30273
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2207
• Name: Human FCER1G (aa 47-86) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI573376; CD23; Fc epsilon receptor Ig; Fc fragment of IgE receptor Ig; Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide; Fc receptor gamma-chain; Fc receptor, IgE, high affinity I, gamma polypeptide; Fce1g; fc-epsilon RI-gamma; FcepsilonRI; FCER1G; FceRI gamma; FcR[g]; FCRG; FcRgamma; FcR-gamma; gamma polypeptide; high affinity immunoglobulin epsilon receptor subunit gamma; IgE Fc receptor subunit gamma; immunoglobulin E receptor, high affinity, gamma chain; Ly-50
• Common Name: FCER1G
• Gene Symbol: FCER1G
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining