Invitrogen™ Human FBXW2 (aa 387-454) Control Fragment Recombinant Protein

Product Code. 30211711

Brand: Invitrogen™ RP103661

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-64343 (PA5-64343. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins. Mammalian F-box proteins are classified into three groups based on the presence of either WD-40 repeats, leucine-rich repeats, or the presence or absence of other protein-protein interacting domains. This gene encodes the second identified member of the F-box gene family and contains multiple WD-40 repeats.

Specifications

• Accession Number: Q9UKT8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 26190
• Name: Human FBXW2 (aa 387-454) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2700071L08Rik; EMBL:AAI66990.1}; F-box and WD repeat domain containing 2; F-box and WD-40 domain protein 2; F-box and WD-40 domain-containing protein 2; F-box and WD-40 domain-containing protein 2 {ECO:0000312; F-box protein Fbw2; F-box/WD repeat-containing protein 2; FBW2; FBXW2; fbxw2 {ECO:0000312; FWD2; MD6; MGC117371; Protein MD6; RGD:1310460}
• Common Name: FBXW2
• Gene Symbol: FBXW2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LYIMDLRTESLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSIHLVLWKEHG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining