Invitrogen™ Human FBXW12 Control Fragment Recombinant Protein

Product Code. 30207326

Brand: Invitrogen™ RP96422

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (46%), Rat (46%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57973 (PA5-57973. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the F-box protein family, such as FBXW12, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603034), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Specifications

• Accession Number: Q6X9E4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 285231
• Name: Human FBXW12 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: F-box and WD repeat domain containing 12; F-box and WD-40 domain protein 12; F-box and WD-40 domain-containing protein 12; F-box- and WD40-repeat-containing protein; F-box only protein 35; F-box/WD repeat-containing protein 12; FBW12; FBXO12; FBXO35; FBXW12
• Common Name: FBXW12
• Gene Symbol: FBXW12
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SPVQEFHFSNLVTLPQMHLAITMDWKKTIKVWNCQDRDALAVLPMPQPCYCMEAYLTKDGPFLMVGDAAGDIYTFTLPGLRDVSKVTAFQY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining