missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30199777

Invitrogen™ Human FBXO27 (aa 86-135) Control Fragment Recombinant Protein

Product Code. 30199777
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30199777 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30199777 Supplier Invitrogen™ Supplier No. RP107148

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66475 (PA5-66475. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

F-box proteins, a critical component of the evolutionary conserved ubiquitin-protein ligase complex SCF (Skp1/Cdc53-Cullin1/F-box), recruit substrates for ubiquitination and consequent degradation through their specific protein-protein interaction domains. Novel human F-box proteins named FBG1, FBG2, FBG3, FBG4 and FBG5 constitute a third subfamily of mammalian F-box proteins. FBG genes are expressed in a limited number of human tissues including kidney, liver, brain and muscle tissues.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q8NI29
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 126433
Name Human FBXO27 (aa 86-135) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias E130008B10Rik; F Box Gama 5; FBG5; F-box only protein 27; F-box protein 27; F-box protein FBG5; F-box/G-domain protein 5; Fbx27; FBXO27; Gm161; rCG54033-like; RGD1563982
Common Name FBXO27
Gene Symbol Fbxo27
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ARSCQSPARNARPCPLGRFCARRPIGRNLIRNPCGQEGLRKWMVQHGGDG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.