Invitrogen™ Human FBXL17 (aa 399-476) Control Fragment Recombinant Protein

Product Code. 30181182

Brand: Invitrogen™ RP97598

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57645 (PA5-57645. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Members of the F-box protein family, such as FBXL17, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1 (MIM 601434), cullin (see CUL1; MIM 603134), and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains (Jin et al., 2004 [PubMed 15520277]).

Specifications

• Accession Number: Q9UF56
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64839
• Name: Human FBXL17 (aa 399-476) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330576B01Rik; AI452053; BB073797; C130023C01Rik; Fbl17; F-box and leucine rich repeat protein 17; F-box and leucine-rich repeat protein 17; F-box only protein 13; F-box/LRR-repeat protein 17; FBX13; FBXL17; Fbxo13
• Common Name: FBXL17
• Gene Symbol: FBXL17
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MSDNGVCVLAFKCPGLLRYTAYRCKQLSDTSIIAVASHCPLLQKVHVGNQDKLTDEGLKQLGSKCRELKDIHFGQCYK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining