Invitrogen™ Human FBXL14 (aa 334-416) Control Fragment Recombinant Protein

Código de producto. 30204211

missing translation for 'mfr': Invitrogen™ RP101460

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FBXL14 is members of the F-box protein family, such as FBXL14, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Especificaciones

• Accession Number: Q8N1E6
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 144699
• Name: Human FBXL14 (aa 334-416) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AW322056; FBL14; F-box and leucine rich repeat protein 14; F-box and leucine-rich repeat protein 14; F-box/LRR-repeat protein 14; Fbx14l; FBXL14; Ppa
• Common Name: FBXL14
• Gene Symbol: Fbxl14
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TLNIGQCVRITDKGLELIAEHLSQLTGIDLYGCTRITKRGLERITQLPCLKVLNLGLWQMTDSEKEARGDFSPLFTVRTRGSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining