Invitrogen™ Human FBRS (aa 98-170) Control Fragment Recombinant Protein

Product Code. 30211975

Brand: Invitrogen™ RP91948

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60615 (PA5-60615. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Fibrosin is a lymphokine secreted by activated lymphocytes that induces fibroblast proliferation.

Specifications

• Accession Number: Q9HAH7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 64319
• Name: Human FBRS (aa 98-170) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Fbrs; FBS; FBS1; fbsh; fibrogenic lymphokine; fibrosin; fibrosin 1; fibrosin-1; FLJ11618; probable fibrosin-1; probable fibrosin-1 long transcript protein
• Common Name: FBRS
• Gene Symbol: Fbrs
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LRHQEKMKGDSHKLDFRNDLLPCLPGPYGALPPGQELSHPASLFTATGAVHAAANPFTAAPGAHGPFLSPSTH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining