Invitrogen™ Human FAT1 (aa 3662-3788) Control Fragment Recombinant Protein

Product Code. 30208612

Brand: Invitrogen™ RP101000

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54910 (PA5-54910. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene is an ortholog of the Drosophila fat gene, which encodes a tumor suppressor essential for controlling cell proliferation during Drosophila development. The gene product is a member of the cadherin superfamily, a group of integral membrane proteins characterized by the presence of cadherin-type repeats. In addition to containing 34 tandem cadherin-type repeats, the gene product has five epidermal growth factor (EGF)-like repeats and one laminin A-G domain. This gene is expressed at high levels in a number of fetal epithelia. Its product probably functions as an adhesion molecule and/or signaling receptor, and is likely to be important in developmental processes and cell communication. Transcript variants derived from alternative splicing and/or alternative promoter usage exist, but they have not been fully described.

Specifications

• Accession Number: Q14517
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 2195
• Name: Human FAT1 (aa 3662-3788) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2310038E12Rik; AU023433; Cadherin family member 7; cadherin FAT1 isoform +12; cadherin ME5; cadherin-related family member 8; cadherin-related tumor suppressor homolog; CDHF7; CDHR8; FAT; fat 1 cadherin; FAT atypical cadherin 1; FAT tumor suppressor 1; FAT tumor suppressor homolog 1; FAT tumor suppressor homolog 1 (Drosophila); FAT1; Fath; hFat1; ME5; mFat1; Protein fat homolog; protocadherin Fat 1; Protocadherin Fat 1, nuclear form
• Common Name: FAT1
• Gene Symbol: FAT1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NFQRALRNILGVRRNDIQIVSLQSSEPHPHLDVLLFVEKPGSAQISTKQLLHKINSSVTDIEEIIGVRILNVFQKLCAGLDCPWKFCDEKVSVDESVMSTHSTARLSFVTPRHHRAAVCLCKEGRCP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining