Invitrogen™ Human FASTKD2 (aa 299-394) Control Fragment Recombinant Protein

Product Code. 30211229

Brand: Invitrogen™ RP107555

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66903 (PA5-66903. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.

Specifications

• Accession Number: Q9NYY8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 22868
• Name: Human FASTKD2 (aa 299-394) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810421I24Rik; FAST kinase domain-containing protein 2; FAST kinase domain-containing protein 2, mitochondrial; FAST kinase domains 2; Fastkd2; KIAA0971; RGD1307883
• Common Name: FASTKD2
• Gene Symbol: Fastkd2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QQVWKIEDVFTLQVVMKCIGKDAPIALKRKLEMKALRELDRFSVLNSQHMFEVLAAMNHRSLILLDECSKVVLDNIHGCPLRIMINILQSCKDLQY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining