Invitrogen™ Human FARS2 (aa 266-380) Control Fragment Recombinant Protein

Product Code. 30196815

Brand: Invitrogen™ RP90675

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55988 (PA5-55988. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS2 is a phenylalanine-tRNA synthetase (PheRS) localized to the mitochondrion which consists of a single polypeptide chain, unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and in the eukaryotic cytoplasm. Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS1 encodes a mitochondrially-located phenylalanine-tRNA synthetase (PheRS) which consists of a single polypeptide chain unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and the eukaryotic cytoplasm.

Specifications

• Accession Number: O95363
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10667
• Name: Human FARS2 (aa 266-380) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: COXPD14; dJ236A3.1 (phenylalanine-tRNA synthetase); dJ520B18.2; dJ520B18.2 (FARS1 (phenylalanine-tRNA synthetase)); Fars1; FARS2; HSPC320; mitochondrial PHERS; pheny; phenylalanine translase; phenylalanine tRNA ligase 2, mitochondrial; phenylalanine--tRNA ligase, mitochondrial; phenylalanine-tRNA synthetase 1 (mitochondrial); phenylalanine-tRNA synthetase 2 (mitochondrial); Phenylalanyl-tRNA synthetase; phenylalanyl-tRNA synthetase 2, mitochondrial; phenylalanyl-tRNA synthetase, mitochondrial; phenylalanyl-tRNA synthetase, mitochondrial; phenylalanine--tRNA ligase, mitochondrial; pheRS
• Common Name: FARS2
• Gene Symbol: FARS2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: CYFPFTHPSFEMEINFHGEWLEVLGCGVMEQQLVNSAGAQDRIGWAFGLGLERLAMILYDIPDIRLFWCEDERFLKQFCVSNINQKVKFQPLSKYPAVINDISFWLPSENYAEND
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining