Invitrogen™ Human FANK1 (aa 220-301) Control Fragment Recombinant Protein

Product Code. 30201344

Brand: Invitrogen™ RP97221

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111098 (PA5-111098. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Through the activation of JUN and AP-1-mediated transcription, may regulate apoptosis.

Specifications

• Accession Number: Q8TC84
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 92565
• Name: Human FANK1 (aa 220-301) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700007B22Rik; AI850911; FANK1; fibronectin type 3 and ankyrin repeat domains 1; fibronectin type 3 and ankyrin repeat domains 1 protein; Fibronectin type 3 and ankyrin repeat domains protein 1; fibronectin type III and ankyrin repeat domains 1; germ cell-specific 1; germ cell-specific gene 1 protein; GSG1; GV14; HSD13; UNQ6504/PRO21382
• Common Name: FANK1
• Gene Symbol: FANK1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GGHCSVIEWMIKDGCEVDVVDTGSGWTPLMRVSAVSGNQRVASLLIDAGANVNVKDRNGKTPLMVAVLNNHEELVQLLLDKG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining