Invitrogen™ Human FANCM (aa 1802-1886) Control Fragment Recombinant Protein

Product Code. 30211196

Brand: Invitrogen™ RP106606

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65927 (PA5-65927. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group M. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q8IYD8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57697
• Name: Human FANCM (aa 1802-1886) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AI427100; ATP-dependent RNA helicase FANCM; C730036B14Rik; D12Ertd364e; FAAP250; FANCM; Fanconi anemia complementation group M; Fanconi anemia group M protein; Fanconi anemia group M protein homolog; Fanconi anemia, complementation group M; fanconi anemia-associated polypeptide of 250 kDa; Kiaa1596; Protein FACM; Protein Hef ortholog; RGD1307897
• Common Name: FANCM
• Gene Symbol: FANCM
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LAGTHTSLRLPQEGKGTCILVGGHEITSGLEVISSLRAIHGLQVEVCPLNGCDYIVSNRMVVERRSQSEMLNSVNKNKFIEQIQH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining