missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. 30203235

Invitrogen™ Human FANCD2 (aa 253-348) Control Fragment Recombinant Protein

Product Code. 30203235
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
This item is not returnable. View return policy

Product Code. 30203235

Brand: Invitrogen™ RP107284

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FANCD2 (Fanconi anemia group D2 protein) is required for maintenance of chromosomal stability. It promotes accurate and efficient pairing of homologs during meiosis. FANCD2 is involved in the repair of DNA double-stranded breaks, both by homologous recombination and single-stranded annealing. It is required for the targeting/stabilization of BLM to non-centromeric abnormal structures induced by replicative stress. FANCD2 promotes BRCA2/FANCD1 loading onto damaged chromatin. Defects in the FANCD2 gene result in Fanconi anemia complementation group D2. This disorder affects all bone marrow elements resulting in anemia, leukopenia, and thrombopenia.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9BXW9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 2177
Name Human FANCD2 (aa 253-348) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2410150O07Rik; AU015151; BB137857; DKFZp762A223; FA4; FACD; FACD2; FAD; FAD2; FA-D2; FANCD; FANCD2; Fanconi anemia complementation group D2; Fanconi anemia D2 protein; Fanconi anemia group D2 protein; Fanconi anemia group D2 protein homolog; Fanconi anemia, complementation group D2; FLJ23826; Protein FACD2
Common Name FANCD2
Gene Symbol FANCD2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RLDPNFLLKVRQLVMDKLSSIRLEDLPVIIKFILHSVTAMDTLEVISELREKLDLQHCVLPSRLQASQVKLKSKGRASSSGNQESSGQSCIILLFD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.