Invitrogen™ Human FAN (aa 135-201) Control Fragment Recombinant Protein

Product Code. 30200197

Brand: Invitrogen™ RP93731

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54707 (PA5-54707. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a WD-repeat protein that binds the cytoplasmic sphingomyelinase activation domain of the 55kD tumor necrosis factor receptor. This protein is required for TNF-mediated activation of neutral sphingomyelinase and may play a role in regulating TNF-induced cellular responses such as inflammation. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q92636
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 8439
• Name: Human FAN (aa 135-201) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA959567; C630007J05; factor associated with neutral sphingomyelinase activation; Factor associated with N-SMase activation; FAN; GRAMD5; neutral sphingomyelinase (N-SMase) activation associated factor; neutral sphingomyelinase activation associated factor; NSMAF; Protein FAN
• Common Name: FAN
• Gene Symbol: NSMAF
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: FELDVPGKVEDVVETLLQLHRASCLDKLGDQTAMITAILQSRLARTSFDKNRFQNISEKLHMECKAE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining