Invitrogen™ Human FAM98B (aa 162-297) Control Fragment Recombinant Protein

Product Code. 30194367

Brand: Invitrogen™ RP89734

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52544 (PA5-52544. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM98B positively stimulates PRMT1-induced protein arginine dimethylated arginine methylation. Promotes colorectal cancer cell malignancy.

Specifications

• Accession Number: Q52LJ0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 283742
• Name: Human FAM98B (aa 162-297) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2610510H03Rik; Fam98b; family with sequence similarity 98 member B; family with sequence similarity 98, member B; protein FAM98B; RGD1564603
• Common Name: FAM98B
• Gene Symbol: FAM98B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: STTSDIPHMLNQVESKVKDILSKVQKNHVGKPLLKMDLNSEQAEQLERINDALSCEYECRRRMLMKRLDVTVQSFGWSDRAKVKTDDIARIYQPKRYALSPKTTITMAHLLAAREDLSKIIRTSSGTSREKTACAI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining