Invitrogen™ Human FAM83C (aa 520-618) Control Fragment Recombinant Protein

Product Code. 30206836

Brand: Invitrogen™ RP103062

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (53%), Rat (53%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62111 (PA5-62111. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q9BQN1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 128876
• Name: Human FAM83C (aa 520-618) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 5530400B04Rik; C20orf128; dJ614O4.7; Fam83c; family with sequence similarity 83 member C; family with sequence similarity 83, member C; ortholog of family with sequence similarity 83, member C FAM83C (5530400B04Rik); protein FAM83C
• Common Name: FAM83C
• Gene Symbol: FAM83C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VGDPDSGVTPNSGPLRPGEQAPEDRRLSPSQADSQLDLLSRALGTGGAPELGSLRPGDRALEDRRLSLNQSRGQSDLLMQYPKAQGSRVPLETNSSARP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining