Invitrogen™ Human FAM71A (aa 288-357) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30211685	100 μL	100µL

Product Code. 30211685 Supplier Invitrogen™ Supplier No. RP108980

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (36%), Rat (36%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-139848 (PA5-139848. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that interacts with the Rab2B small GTPase and may be important for integrity of the Golgi body. A knockdown of this gene induces fragmentation of the Golgi, similar to the effect seen with a knockdown of the Rab2B small GTPase. The encoded protein has an N-terminal Rab-binding domain specific for Rab2B.

Specifications

• Accession Number: Q8IYT1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 149647
• Name: Human FAM71A (aa 288-357) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FAM71A; family with sequence similarity 71 member A; family with sequence similarity 71, member A; protein FAM71A; testis secretory sperm-binding protein Li 209 A
• Common Name: FAM71A
• Gene Symbol: FAM71A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ATGTVAGALSVAAANSAPGQVSAAIAGAATIGAGGNKGNMALAGTASMAPNSTKVAVAGAAGKSSEHVSS
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining