Invitrogen™ Human FAM55D (aa 267-339) Control Fragment Recombinant Protein

Product Code. 30212523

Brand: Invitrogen™ RP97345

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60128. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The function remains unknown.

Specifications

• Accession Number: Q6UWF7
• Concentration: 1 mg/mL
• For Use With (Application): Neutralization, Control
• Formulation: PBS, 1M urea with no preservative; pH 7.4
• Gene ID (Entrez): 54827
• Name: Human FAM55D (aa 267-339) Control Fragment
• pH Range: 7.4
• Purification Method: Metal-chelate chromatography
• Quantity: 100 μL
• Storage Requirements: -20°C, Avoid Freeze/Thaw Cycles
• Regulatory Status: RUO
• Gene Alias: C11orf33; C130036J11; D930028F11Rik; Fam55b; Fam55d; family with sequence similarity 55, member B; family with sequence similarity 55, member D; hypothetical protein LOC244853; hypothetical protein LOC515648; LOC100731209; neurexophilin and PC-esterase domain family member 4; neurexophilin and PC-esterase domain family, member 4; NXPE family member 4; Nxpe4; Protein FAM55D; UNQ3018/PRO9799
• Common Name: FAM55D
• Gene Symbol: NXPE4
• Product Type: Protein
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LSKQEKSLFERSNVGVEIMEKFNTISVSKCNKETVAMKEKCKFGMTSTIPSGHVWRNTWNPVSCSLATVKMKE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining