Invitrogen™ Human FAM53C (aa 260-358) Control Fragment Recombinant Protein

Artikelnummer. 30211532

Marke: Invitrogen™ RP100131

Beschreibung

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60125 (PA5-60125. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the FAM53 protein family. FAM53 protein family members bind to a transcriptional regulator that modulates cell proliferation. Alternative splicing results in multiple transcript variants.

Spezifikation

• Accession Number: Q9NYF3
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51307
• Name: Human FAM53C (aa 260-358) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 2810012G03Rik; C5orf6; FAM53C; family with sequence similarity 53 member C; family with sequence similarity 53, member C; Gm21179; Protein FAM53C; putative nuclear protein
• Common Name: FAM53C
• Gene Symbol: FAM53C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WRPRGLRNLPRSRSQPCDLDARKTGVKRRHEEDPRRLRPSLDFDKMNQKPYSGGLCLQETAREGSSISPPWFMACSPPPLSASCSPTGGSSQVLSESEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining