Invitrogen™ Human FAM50A (aa 68-173) Control Fragment Recombinant Protein

Product Code. 30193821

Brand: Invitrogen™ RP92167

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51968 (PA5-51968. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

May be a DNA-binding protein or transcriptional factor.

Specifications

• Accession Number: Q14320
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9130
• Name: Human FAM50A (aa 68-173) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9 F; D0HXS9928E; DXS9928E; FAM50A; family with sequence similarity 50 member A; family with sequence similarity 50, member A; HXC26; HXC-26; Protein FAM50A; Protein HXC-26; Protein XAP-5; RGD1560964; XAP5; XAP-5; XX-FW81657B9.2
• Common Name: FAM50A
• Gene Symbol: FAM50A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VTLNDMKAKQEALVKEREKQLAKKEQSKELQMKLEKLREKERKKEAKRKISSLSFTLEEEEEGGEEEEEAAMYEEEMEREEITTKKRKLGKNPDVDTSFLPDRDRE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining