Invitrogen™ Human FAM40A (aa 323-382) Control Fragment Recombinant Protein

Product Code. 30211008

Brand: Invitrogen™ RP105154

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66330 (PA5-66330. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics and cell shape.

Specifications

• Accession Number: Q5VSL9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 85369
• Name: Human FAM40A (aa 323-382) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6330569M22Rik; 6530401O14Rik; Fam40a; family with sequence similarity 40, member A; FAR11 factor arrest 11 homolog A; FAR11A; homolog of yeast FAR11 protein 1; hypothetical protein; Kiaa1761; Protein FAM40A; QnpA-18494; RP4-773N10.1; striatin interacting protein 1; striatin-interacting protein 1; striatin-interacting protein 1; LOW QUALITY PROTEIN: striatin-interacting protein 1; Strip1
• Common Name: FAM40A
• Gene Symbol: STRIP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DSIKVIRNMRAASPPASASDLIEQQQKRGRREHKALIKQDNLDAFNERDPYKADDSREEE
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining