Invitrogen™ Human FAM217A (aa 132-232) Control Fragment Recombinant Protein

Product Code. 30212089

Brand: Invitrogen™ RP94876

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57277 (PA5-57277. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM217A is a protein coding gene.

Specifications

• Accession Number: Q8IXS0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 222826
• Name: Human FAM217A (aa 132-232) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700026J04Rik; C35H6orf146; C6orf146; Fam217a; family with sequence similarity 217 member A; family with sequence similarity 217, member A; LOW QUALITY PROTEIN: protein FAM217A; protein FAM217A; uncharacterized protein C6orf146; uncharacterized protein C6orf146 homolog
• Common Name: FAM217A
• Gene Symbol: FAM217A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SVDKQVGPYPGLPMPLGLCWPYADGDFFKNRNEIHVSSCSTIENNDGETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKPETIK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining