Invitrogen™ Human FAM212B (aa 75-148) Control Fragment Recombinant Protein

Product Code. 30211587

Brand: Invitrogen™ RP94549

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (64%), Rat (64%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55698 (PA5-55698. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM212B (INKA2, Inka Box Actin Regulator 2) is a Protein Coding gene. An important paralog of this gene is ENSG00000284755. Inhibitor of the serine/threonine-protein kinase PAK4. Acts by binding PAK4 in a substrate-like manner, inhibiting the protein kinase activity.

Specifications

• Accession Number: Q9NTI7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 55924
• Name: Human FAM212B (aa 75-148) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6530418L21Rik; C1orf183; C3H1orf183; FAM212B; family with sequence similarity 212 member B; family with sequence similarity 212, member B; HInca-r; Induced in neural crest by AP2-alpha protein-related homolog; Inka box actin regulator 2; Inka2; MInca-r; PAK4-inhibitor INKA2; protein FAM212B; RGD1306526; uncharacterized protein C1orf183 homolog
• Common Name: FAM212B
• Gene Symbol: FAM212B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EHPCWEGGRGPARPTVCSPSSQPSLGSSTKFPSHRSVCGRDLAPLPRTQPHQSCAQQGPERVEPDDWTSTLMSR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining