Invitrogen™ Human FAM196B (aa 52-137) Control Fragment Recombinant Protein

Product Code. 30212285

Brand: Invitrogen™ RP100312

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61471 (PA5-61471. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: A6NMK8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 100131897
• Name: Human FAM196B (aa 52-137) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C5orf57; FAM196B; family with sequence similarity 196 member B; family with sequence similarity 196, member B; Inhibitory synaptic factor family member 2 B; INSYN2B; protein FAM196B; Protein INSYN2B
• Common Name: FAM196B
• Gene Symbol: FAM196B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AEVDVQTPEDPAVMGKTQATRHHLPPTYSLSFPRSQKAGGFRNIAIQTSPSLRKHFPVFKRKRLTASKSLVEMPTASQSAIQVNGN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining