Invitrogen™ Human FAM184B (aa 307-410) Control Fragment Recombinant Protein

Product Code. 30206597

Brand: Invitrogen™ RP100189

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60616 (PA5-60616. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

KIAA1276 was first identified as a hypothetical protein predicted from the in silico analysis of long cDNAs isolated in the Kazusa cDNA sequencing project. The function of KIAA1276 has not been characterized; however KIAA1276 homozygous knockout mice are viable.

Specifications

• Accession Number: Q9ULE4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 27146
• Name: Human FAM184B (aa 307-410) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FAM184B; family with sequence similarity 184 member B; family with sequence similarity 184, member B; KIAA1276; Protein FAM184B
• Common Name: FAM184B
• Gene Symbol: FAM184B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ARQENSELKGTAKKLGEKLAVAKDRMMLQECRGTQQTDAMKTELVSENKVLREENDLEAGNLHPQQDQSCLKECPCMKGGTDMQTKKEASAETEYMKQQYEEDL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining