Invitrogen™ Human FAM155A (aa 347-417) Control Fragment Recombinant Protein

Product Code.	Quantity	unitSize
30203352	100 μL	100µL

Product Code. 30203352 Supplier Invitrogen™ Supplier No. RP105111

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (79%), Rat (79%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM155A gene ontology annotations related to this gene include calcium ion import across plasma membrane.

Specifications

• Accession Number: B1AL88
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 728215
• Name: Human FAM155A (aa 347-417) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 6430500D16; AW121567; Fam155a; family with sequence similarity 155 member A; family with sequence similarity 155, member A; RGD1559498; Tmem28; transmembrane protein 28; transmembrane protein FAM155A
• Common Name: FAM155A
• Gene Symbol: FAM155A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DNDEVIYGGLSSFICTGLYETFLTNDEPECCDVRREEKSNNPSKGTVEKSGSCHRTSLTVSSATRLCNSRL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining