Invitrogen™ Human FAM135B (aa 588-674) Control Fragment Recombinant Protein

Product Code. 30201294

Brand: Invitrogen™ RP93823

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (57%), Rat (57%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55193 (PA5-55193. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

FAM135B gene ontology annotations related to this gene include cellular lipid metabolic process.

Specifications

• Accession Number: Q49AJ0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 51059
• Name: Human FAM135B (aa 588-674) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1700010C24Rik; A830008O07Rik; C8ORFK32; FAM135B; family with sequence similarity 135 member B; family with sequence similarity 135, member B; LOC100726490; Protein FAM135B; RGD1308133
• Common Name: FAM135B
• Gene Symbol: FAM135B
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DRTGLSKVVVGGSHQNAISSDKTTLHELSTLGKGIDQEGKMVLLSLKLTPSEPCDPLSSTLREPLDIRSSLKDSHTEEQEELSVLSG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining