Invitrogen™ Human FAM132B (aa 67-113) Control Fragment Recombinant Protein

Product Code. 30211886

Brand: Invitrogen™ RP108109

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67448 (PA5-67448. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Iron-regulatory hormone that acts as an erythroid regulator after hemorrhage: produced by erythroblasts following blood loss and mediates suppression of hepcidin (HAMP) expression in the liver, thereby promoting increased iron absorption and mobilization from stores. Promotes lipid uptake into adipocytes and hepatocytes via transcriptional up-regulation of genes involved in fatty acid uptake.

Specifications

• Accession Number: Q4G0M1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 151176
• Name: Human FAM132B (aa 67-113) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C1QTNF15; complement C1q tumor necrosis factor-related protein 15; CTRP15; ERFE; Erythroferrone; FAM132B; family with sequence similarity 132 member B; family with sequence similarity 132, member B; myonectin; protein FAM132B
• Common Name: FAM132B
• Gene Symbol: ERFE
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EPTAERAHSVDPRDAWMLFVRQSDKGVNGKKRSRGKAKKLKFGLPGP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining