Invitrogen™ Human FAM129C (aa 133-210) Control Fragment Recombinant Protein

Product Code. 30182544

Brand: Invitrogen™ RP99149

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60306 (PA5-60306. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications

• Accession Number: Q86XR2
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 199786
• Name: Human FAM129C (aa 133-210) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B-cell novel protein 1; BCNP1; BCNP1 homolog; FAM129C; family with sequence similarity 129 member C; family with sequence similarity 129, member C; NIBAN3; niban-like protein 2; Protein FAM129C; Protein Niban 3
• Common Name: FAM129C
• Gene Symbol: FAM129C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: HKEEYENGGHCLGSTALTGYTLLTSQREYLRLLDALCPESLGDHTQEEPDSLLEVPVSFPLFLQHPFRRHLCFSAATR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining