Invitrogen™ Human FAM120C (aa 494-572) Control Fragment Recombinant Protein

Product Code. 30199635

Brand: Invitrogen™ RP109958

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-144848 (PA5-144848. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a potential transmembrane protein and lies in a region where mutations and deletions have been associated with intellectual disability and autism. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q9NX05
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54954
• Name: Human FAM120C (aa 494-572) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: constitutive coactivator of PPAR-gamma-like protein 2; CXorf17; D930001I21Rik; FAM120C; family with sequence similarity 120, member C; family with sequence similarity 120 C; ORF34; Protein FAM120C; RGD1564253; si:dkey-206f21.2; tumor antigen BJ-HCC-21
• Common Name: FAM120C
• Gene Symbol: FAM120C
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NWAVSYDSSASQFPNYLPSKASPPLGPDSSHSSSSDGDEPNGASSDHITEAFHHQPEWGNPNRDRGSWAQPVDTGVSEA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining